PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.7524s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family TALE
Protein Properties Length: 396aa    MW: 45396.3 Da    PI: 6.5496
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.7524s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.4e-093213562055
                          HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
             Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                          +k +yps++e+  LA+++gL+++q+ +WF N+R ++
  Cagra.7524s0001.1.p 321 YKWPYPSESEKVALAESTGLDQKQINNWFINQRKRH 356
                          5679*****************************885 PP

2ELK35.91.6e-12276297122
                  ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                          ELK++Ll+KYsgyL+sLkqE+s
  Cagra.7524s0001.1.p 276 ELKNHLLKKYSGYLSSLKQELS 297
                          9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012557.6E-23129173IPR005540KNOX1
PfamPF037902.3E-22130171IPR005540KNOX1
SMARTSM012562.2E-30181232IPR005541KNOX2
PfamPF037916.5E-26186231IPR005541KNOX2
PfamPF037897.9E-10276297IPR005539ELK domain
PROSITE profilePS5121311.243276296IPR005539ELK domain
SMARTSM011881.0E-6276297IPR005539ELK domain
PROSITE profilePS5007113.021296359IPR001356Homeobox domain
SuperFamilySSF466891.41E-19297371IPR009057Homeodomain-like
SMARTSM003894.0E-13298363IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.9E-27301362IPR009057Homeodomain-like
CDDcd000861.05E-11308360No hitNo description
PfamPF059201.2E-16316355IPR008422Homeobox KN domain
PROSITE patternPS000270334357IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001708Biological Processcell fate specification
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010089Biological Processxylem development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MEEYQHDSSS TPHRVSFLYS PISSSSNKND NTSDTNNNNN NNSNNYGPGY NNTNNNHQQH  60
HHQHMLFPHM SSLLPQTTEN CFRSDHDQPN NPSVKSEASS SRINHYSMLM RAIHNTQDAT  120
NNDNVADVEA MKAKIIAHPH YSTLLQAYLD CQKIGAPPEV VDRITAARQD FEARQQRSTP  180
SLSASSKDPE LDQFMEAYCD MLVKYREELT RPIQEAMEFI RRIESQLSML CQGPIHILNN  240
PDGKSEGMGS SDEEQENNSG GETELPEIDP RAEDRELKNH LLKKYSGYLS SLKQELSKKK  300
KKGKLPKEAR QKLLTWWELH YKWPYPSESE KVALAESTGL DQKQINNWFI NQRKRHWKPS  360
EDMQFMVMDG LQHPHHAALY MDGHYMGDGP YRLGP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankATU141740.0U14174.1 Arabidopsis thaliana clone KNAT1 knotted-like homeobox protein gene, partial cds.
GenBankAY0808340.0AY080834.1 Arabidopsis thaliana putative KNAT1 homeobox protein (At4g08150) mRNA, complete cds.
GenBankAY1139820.0AY113982.1 Arabidopsis thaliana putative KNAT1 homeobox protein (At4g08150) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010455230.10.0PREDICTED: homeobox protein knotted-1-like 1 isoform X2
SwissprotP466390.0KNAT1_ARATH; Homeobox protein knotted-1-like 1
TrEMBLR0FIH20.0R0FIH2_9BRAS; Uncharacterized protein
STRINGAT4G08150.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65662335
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.10.0KNOTTED-like from Arabidopsis thaliana